Invitrogen™ Human RPP38 (aa 189-277) Control Fragment Recombinant Protein

Code produit. 30207381

Marque: Invitrogen™ RP100663

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111212 (PA5-111212. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. RPP38 may associate transiently with RNase P RNA as a factor involved in the transport of H1 RNA to the putative site of its assembly in the cell, the nucleolus.

Spécification

• Accession Number: P78345
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10557
• Name: Human RPP38 (aa 189-277) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C330006A15Rik; ribonuclease P protein subunit p38; ribonuclease P/MRP 38 subunit; ribonuclease P/MRP 38 kDa subunit; ribonuclease P/MRP subunit p38; RNaseP protein p38; RPP38
• Common Name: RPP38
• Gene Symbol: RPP38
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining