Invitrogen™ Human RPP25L (aa 1-48) Control Fragment Recombinant Protein

Product Code. 30205584

Brand: Invitrogen™ RP106961

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66275 (PA5-66275. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be a component of ribonuclease P or MRP.

Specifications

• Accession Number: Q8N5L8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 138716
• Name: Human RPP25L (aa 1-48) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810432D09Rik; alba-like protein C9orf23; alba-like protein C9orf23 homolog; AW987258; bA296L22.5; C9orf23; RGD1306576; Ribonuclease P protein subunit p25-like protein; ribonuclease P/MRP 25 subunit-like; ribonuclease P/MRP 25 kDa subunit-like; ribonuclease P/MRP subunit p25 like; RNase P protein subunit-like p25; Rpp25l; Rpp25-like protein; Rppl25
• Common Name: RPP25L
• Gene Symbol: RPP25L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining