Invitrogen™ Human RPL3 (aa 140-246) Control Fragment Recombinant Protein

Product Code. 30208122

Brand: Invitrogen™ RP102209

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51912 (PA5-51912. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This protein interacts with cell division cycle 5-like, associates with human splicing complexes, and plays a role in pre-mRNA splicing.

Specifications

• Accession Number: P39023
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6122
• Name: Human RPL3 (aa 140-246) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 60 S ribosomal protein L3; ASC-1; F2; HIV-1 TAR RNA-binding protein B; J1; J1 protein; L3; L4; Large ribosomal subunit protein uL3; OK/SW-cl0.32; ribosomal protein L3; ribosomal protein L3 homolog; ribosomal protein L3, isoform a; RL3; RPL3; TARBP-B
• Common Name: RPL3
• Gene Symbol: RPL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining