Invitrogen™ Human RPL21 (aa 9-38) Control Fragment Recombinant Protein

Product Code. 30210796

Brand: Invitrogen™ RP100807

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61479 (PA5-61479. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the protein kinase C and casein kinase substrate in neurons family. The encoded protein is involved in linking the actin cytoskeleton with vesicle formation. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: P46778
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6144
• Name: Human RPL21 (aa 9-38) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 60 S ribosomal protein L21; 8430440E03Rik; HYPT12; L21; Large ribosomal subunit protein eL21; ribosomal protein L21; ribosomal protein L21 pseudogene 16; Rpl21; RPL21P16; similar to ribosomal protein L21
• Common Name: RPL21
• Gene Symbol: Rpl21
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGTRYMFSRPFRKHGVVPLATYMRIYKKGD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining