Invitrogen™ Human RPL17 (aa 131-176) Control Fragment Recombinant Protein

Product Code. 30181861

Brand: Invitrogen™ RP99539

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83815 (PA5-83815. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L22P family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as rpL23 because the encoded protein shares amino acid identity with ribosomal protein L23 from Halobacterium marismortui; however, its official symbol is RPL17. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream C18orf32 gene.

Specifications

• Accession Number: P18621
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6139
• Name: Human RPL17 (aa 131-176) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 60 S ribosomal protein L17; 60 S ribosomal protein L23; Amino acid starvation-induced protein; ASI; gene encoding putative NFkB activating protein; L17; L23; Large ribosomal subunit protein uL22; MGC117162; PD-1; ribosomal protein L17; RPL17; RPL23
• Common Name: RPL17
• Gene Symbol: Rpl17
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining