Invitrogen™ Human RPA4 (aa 1-74) Control Fragment Recombinant Protein

Product Code. 30202366

Brand: Invitrogen™ RP103779

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64256 (PA5-64256. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The single-stranded-DNA-binding proteins (SSBs) are essential for DNA function in prokaryotic and eukaryotic cells, mitochondria, phages and viruses. Replication protein A (RPA), a highly conserved eukaryotic protein, is a heterotrimeric SSB consisting of three subunits that play an important role in DNA replication, recombination and repair. RPA is one of the major damage- recognition structures involved in the early stage of nucleotide excision repair and may function in telomere maintenance. The binding of human RPA (hRPA) to DNA involves molecular polarity, in which initial hRPA binding occurs on the 5' side of a ssDNA substrate and then extends in the 3' direction to create a stably bound hRPA. Widely expressed at low to intermediate levels, RPA 34 kDa subunit, which is also known as RPA4 (replication factor A protein 4), contains 261 amino acids, localizes to nucleus and is preferentially expressed in mucosa of colon and placenta.

Specifications

• Accession Number: Q13156
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29935
• Name: Human RPA4 (aa 1-74) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: HSU24186; MGC120333; MGC120334; Replication factor A protein 4; replication protein A 30 kDa subunit; replication protein A complex 34 kd subunit homolog Rpa4; replication protein A4; replication protein A4, 30 kDa; replication protein A4, 34 kDa; RF-A protein 4; RP-A p30; RPA4
• Common Name: RPA4
• Gene Symbol: RPA4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining