Invitrogen™ Human ROS1 (aa 1694-1779) Control Fragment Recombinant Protein

Product Code. 30205502

Brand: Invitrogen™ RP101100

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83949 (PA5-83949. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ROS1 is a tyrosine kinase that functions as a growth or differentiation factor receptor. Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The tyrosine kinase (TK) group is mainly involved in the regulation of cell-cell interactions such as differentiation, adhesion, motility and death. There are currently about 90 TK genes sequenced, 58 are of receptor protein TK (e.g. EGFR, EPH, FGFR, PDGFR, TRK, and VEGFR families), and 32 of cytosolic TK (e.g. ABL, FAK, JAK, and SRC families).

Specifications

• Accession Number: P08922
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6098
• Name: Human ROS1 (aa 1694-1779) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: c-ros; c-ros oncogene 1 , receptor tyrosine kinase; c-Ros receptor tyrosine kinase; c-ros-1; heart - derived c - ros - 1 proto - oncogene; MCF3; Proto-oncogene c-Ros; proto-oncogene c-Ros-1; Proto-oncogene tyrosine-protein kinase ROS; receptor tyrosine kinase c-ros oncogene 1; ROS; ROS proto-oncogene 1 , receptor tyrosine kinase; ROS proto-oncogene 1, receptor tyrosine kinase; Ros1; Ros-1; Ros1 proto-oncogene; ROS1C; RP1-179P9.1; transmembrane tyrosine-specific protein kinase; v-ros avian UR2 sarcoma virus oncogene homolog 1; v-ros UR2 sarcoma virus oncogene homolog 1
• Common Name: ROS1
• Gene Symbol: ROS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENSTSLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining