Invitrogen™ Human ROPN1L (aa 163-228) Control Fragment Recombinant Protein

Product Code. 30210052

Brand: Invitrogen™ RP96880

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58689 (PA5-58689. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Principal Names: ROPN1L; Ropporin-1 like; ASP; AKAP-associated sperm protein; Official Gene Symbol: ROPN1L Gene ID: 83853 (human) Gene Map Locus: 5p15.2 (human) AKAPs act as scaffolding proteinscoordinating phosphatase/kinase signaling at the cytoskeleton. They interact with PKAs and anchor them to specific sub-cellular compartments and participate in multiple cellular processes including growth, metabolism and differentiation. ASP, a 26 kDa protein, is a novel AKAP-interacting protein. It interacts with the amphipathic helix of AKAP3 and facilitates AKAP3-PKA interactions. It consists of a conserved N-terminal AKAP-binding domain and a central cysteine-rich Fz domain. It is specifically expressed in the sperms and might play a significant role in sperm motility and also facilitate cytoskeletal reorganization during spermiogenesis.

Specifications

• Accession Number: Q96C74
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83853
• Name: Human ROPN1L (aa 163-228) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Akapasp; AKAP-associated sperm protein; A-kinase anchoring protein-associated sperm protein; ASP; AV047578; radial spoke head 11 homolog; rhophilin associated tail protein 1 like; rhophilin associated tail protein 1-like; ROPN1L; ROPN1-like protein; ropporin 1-like; ropporin-1-like protein; RSPH11
• Common Name: ROPN1L
• Gene Symbol: Ropn1l
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining