Invitrogen™ Human RON (aa 768-875) Control Fragment Recombinant Protein

Product Code. 30200748

Brand: Invitrogen™ RP89803

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110741 (PA5-110741. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MST1R (RON) is a receptor tyrosine kinase involved in cell proliferation and motility. The protein is a membrane-spanning, disulfide-linked heterodimer, which results from cleavage of a glycosylated precursor into 35-kD (alpha) and 150-kD (beta) subunits. Ligand binding results in tyrosine phosphorylation of the beta chain. In knockout studies, MST1R/RON (-/-) mice failed to survive past the periimplantation period. The MST1R/RON gene has been mapped to 3p21, a region of frequent deletion or mutation in small cell lung and renal carcinoma, and has been implicated in the progression of several epithelial cancers. MST1R/Ron expression has been documented in many normal human tissues. ESTs have been isolated from several tissue libraries, including normal colon, mouth, prostate, and testis and cancerous colon, prostate, stomach, and uteru.

Specifications

• Accession Number: Q04912
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4486
• Name: Human RON (aa 768-875) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CD136; Cdw136; c-met-related tyrosine kinase; friend virus susceptibility 2; Fv2; Fv-2; macrophage stimulating 1 receptor; macrophage stimulating 1 receptor (c-met-related tyrosine kinase); macrophage-stimulating protein receptor; Macrophage-stimulating protein receptor alpha chain; Macrophage-stimulating protein receptor beta chain; MSP receptor; Mst1r; MST1R variant RON30; MST1R variant RON62; p185-Ron; protein tyrosine kinase 8; Protein-tyrosine kinase 8; PTK8; PTK8 protein tyrosine kinase 8; receptor protein tyrosine kinase, c-met-related; RON; RON variant E2E3; Stem cell-derived tyrosine kinase; STK
• Common Name: RON
• Gene Symbol: MST1R
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining