missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ROCK2 (aa 403-525) Control Fragment Recombinant Protein

Product Code. 30209720
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209720

Brand: Invitrogen™ RP89785

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ROCK2, the predominant ROCK isoform in skeletal muscle, is an important regulator downstream of Rho GTPases. ROCK2 regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75116
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9475
Name Human ROCK2 (aa 403-525) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B230113H15Rik; KIAA0619; mKIAA0619; p150 ROK-alpha; p164 ROCK-2; Rho associated coiled-coil containing protein kinase 2; Rho kinase 2; RhoA - binding serine/threosine kinase alpha (ROK - alpha); rhoA-binding kinase 2; Rho-associated coiled-coil containing protein kinase 2; Rho-associated coiled-coil forming kinage 2; Rho-associated coiled-coil forming kinase 2; rho-associated protein kinase 2; Rho-associated, coiled-coil-containing protein kinase 2; rho-associated, coiled-coil-containing protein kinase II; Rho-kinase; ROCK II; Rock2; Rock2m; rockii; ROCK-II; ROK; ROKalpha
Common Name ROCK2
Gene Symbol ROCK2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.