Invitrogen™ Human RNH1 (aa 304-397) Control Fragment Recombinant Protein

Product Code. 30194630

Brand: Invitrogen™ RP97271

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59295 (PA5-59295. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNH1 is the inhibitor of pancreatic RNase and angiogenin. RNH1 may also function in the modulation of cellular activities.

Specifications

• Accession Number: P13489
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6050
• Name: Human RNH1 (aa 304-397) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW546468; C80305; EGK_05816; hypothetical protein LOC517087; im:7039360; LOC720791; Placental ribonuclease inhibitor; placental RNase inhibitor; PRI; RAI; Ribonuclease inhibitor; ribonuclease/angiogenin inhibitor 1; RNH; Rnh1; si:ch211-213a13.3; testicular tissue protein Li 164; uncharacterized protein rnh1; wu:fd55g05
• Common Name: RNH1
• Gene Symbol: RNH1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLAN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining