Invitrogen™ Human RNF39 (aa 142-234) Control Fragment Recombinant Protein

Product Code. 30180489

Brand: Invitrogen™ RP99611

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61431 (PA5-61431. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that this gene encodes a protein that plays a role in an early phase of synaptic plasticity. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9H2S5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80352
• Name: Human RNF39 (aa 142-234) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC038661; DADB-60O11.8; Gm1786; Gm1787; Gm320; HZF; HZFW; Hzfw1; HZFw1 protein; Lirf; LTP (long-term potentiation) induced RING finger protein; LTP-induced RING finger protein; Protein HZFw; RING finger protein 39; RNF39
• Common Name: RNF39
• Gene Symbol: Rnf39
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPTMGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKMLHRLTADLTLDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining