Invitrogen™ Human RNF36 (aa 14-157) Control Fragment Recombinant Protein

Product Code. 30203559

Brand: Invitrogen™ RP102305

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56006 (PA5-56006. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the RING-B-box-coiled-coil (RBCC) family and encodes a protein with an N-terminal RING finger motif, a PRY domain and a C-terminal SPRY domain. The mouse ortholog of this gene is specifically expressed in germ cells at the round spermatid stages during spermatogenesis and, when overexpressed, induces apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Specifications

• Accession Number: Q86WT6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 140691
• Name: Human RNF36 (aa 14-157) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921519C19Rik; E3 ubiquitin-protein ligase TRIM69; hCG_39321; HSD34; HSD-34; RFP-like (B30.2) domain protein; RFP-like domain-containing protein trimless; RING finger B-box coiled-coil transcription factor; ring finger protein 36; RING-type E3 ubiquitin transferase TRIM69; RNF36; testis-specific RING finger protein; Trif; Trim69; Trimless; tripartite motif containing 69; tripartite motif-containing 69; tripartite motif-containing protein 69
• Common Name: RNF36
• Gene Symbol: TRIM69
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GDYVEMNDSITHLPSKVVIQDITMELHCPLCNDWFRDPLMLSCGHNFCEACIQDFWRLQAKETFCPECKMLCQYNNCTFNPVLDKLVEKIKKLPLLKGHPQCPEHGENLKLFSKPDGKLICFQCKDARLSVGQSKEFLQISDAV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining