Invitrogen™ Human RNF34 (aa 59-123) Control Fragment Recombinant Protein

Product Code. 30203873

Brand: Invitrogen™ RP105587

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67332 (PA5-67332. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Specifications

• Accession Number: Q969K3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80196
• Name: Human RNF34 (aa 59-123) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW061037; AW536122; BC004042; C88279; CARP1; CARP-1; Caspase regulator CARP1; caspases-8 and -10-associated RING finger protein 1; E3 ubiquitin-protein ligase RNF34; FLJ21786; FYVE-RING finger protein MOMO; hRFI; Human RING finger homologous to inhibitor of apoptosis protein; Momo; phafin 1; phafin-1; RFI; RIF; RIFF; ring finger protein 34; ring finger protein 34, E3 ubiquitin protein ligase; RING finger protein MOMO; RING finger protein RIFF; RING-type E3 ubiquitin transferase RNF34; RNF34
• Common Name: RNF34
• Gene Symbol: RNF34
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining