missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RNF34 (aa 59-123) Control Fragment Recombinant Protein

Product Code. 30203873
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203873

Brand: Invitrogen™ RP105587

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67332 (PA5-67332. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q969K3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80196
Name Human RNF34 (aa 59-123) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW061037; AW536122; BC004042; C88279; CARP1; CARP-1; Caspase regulator CARP1; caspases-8 and -10-associated RING finger protein 1; E3 ubiquitin-protein ligase RNF34; FLJ21786; FYVE-RING finger protein MOMO; hRFI; Human RING finger homologous to inhibitor of apoptosis protein; Momo; phafin 1; phafin-1; RFI; RIF; RIFF; ring finger protein 34; ring finger protein 34, E3 ubiquitin protein ligase; RING finger protein MOMO; RING finger protein RIFF; RING-type E3 ubiquitin transferase RNF34; RNF34
Common Name RNF34
Gene Symbol RNF34
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.