Invitrogen™ Human RNF31 (aa 660-789) Control Fragment Recombinant Protein

Product Code. 30201744

Brand: Invitrogen™ RP89026

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61812 (PA5-61812. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lyn proto oncogene (Lcl/Yes related novel protein tyrosine kinase) is encoded by the Lyn gene located on chromosome 8 in humans and belongs to the Src family kinase. It is a non-receptor tyrosine kinase that acts as a mediator in transducing cellular signaling. The most well studied expression of Lyn is in hematopoietic cell types, both lymphoid and myeloid cells with exclusion in T lymphocytes. It has also been observed that Lyn plays diverse roles such as in regulation of B cell receptor signaling, mast cell signaling and Epithelial - Mesenchymal Transition (EMT).

Specifications

• Accession Number: Q96EP0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55072
• Name: Human RNF31 (aa 660-789) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL033293; BC031509; E3 ubiquitin-protein ligase RNF31; Flj10111; FLJ23501; HOIL-1-interacting protein; HOIP; mFLJ00217; MGC19975; Paul; putative Ariadne-like ubiquitin ligase; RING finger protein 31; RING-type E3 ubiquitin transferase RNF31; Rnf31; ZIBRA; Zinc in-between-RING-finger ubiquitin-associated domain protein
• Common Name: RNF31
• Gene Symbol: RNF31
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining