Invitrogen™ Human RNF216 (aa 288-367) Control Fragment Recombinant Protein

Product Code. 30202630

Brand: Invitrogen™ RP92071

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82649 (PA5-82649. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Activation of NF-κB as a result of Toll-like receptor (TLR) and IL-1 receptor signaling is a major component of innate immune responses. Signals from these receptors are relayed by a number of adapter molecules such as TRIF, TIRAP, and MyD88. Several regulatory mechanisms exist to control TLR signal transduction, including the inhibition of TLR expression and signaling by molecules such as ST2 and SIGIRR. Another mechanism is by the ubi-quitinization of selected TLRs by TRIAD3A, an E3 ubiquitin-protein ligase. TRIAD3A is a RING finger protein that can bind to TLR4 and TLR9, and to a lesser extent TLR3 and TLR5, catalyzing the ubiquitization of these molecules. Overexpression of TRIAD3A promoted the nearly complete degradation of TLR4 and TLR9; this reduction was reflected in the decreased signal-specific activation by ligands specific for these TLRs. Conversely, depletion of TRIAD3A resulted in enhanced TLR activation.

Specifications

• Accession Number: Q9NWF9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54476
• Name: Human RNF216 (aa 288-367) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810055G22Rik; AI647468; AU019462; C86502; CAHH; E3 ubiquitin ligase; E3 ubiquitin-protein ligase RNF216; F830018F18Rik; RGD1565135; RING finger protein 216; RING-type E3 ubiquitin transferase RNF216; RNF216; Triad domain-containing protein 3; TRIAD3; triad3a; U7I1; UBCE7IP1; UbcM4-interacting protein 83; ubiquitin-conjugating enzyme 7-interacting protein 1; Uip83; Zin; zinc finger protein inhibiting NF-kappa-B
• Common Name: RNF216
• Gene Symbol: RNF216
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VKETEARFPDVANGFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPSSSLLASQDETKLPKIDFFDYSKLTPLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining