missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181620

Invitrogen™ Human RNF17 (aa 465-568) Control Fragment Recombinant Protein

Product Code. 30181620
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181620

Brand: Invitrogen™ RP97954

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59070 (PA5-59070. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNF17 also termed as ring finger protein 17 is a 1623 amino acid protein, which contains 1 ring type zinc finger and 4 tudor domains. RNF17 is specifically expressed in testis. The RING finger motif presents in many ubiquitin E3 ligases. RNF17 interacts with all four members of the Mad family (Mad1, Mxi1, Mad3 and Mad4), which are basic-helix-loop-helix-leucine zipper transcription factors of the Myc oncoprotein network. RNF17 is component of the tectonic-like complex, which is required for ciliogenesis and sonic hedgehog/SHH signaling. RNF17 is able to form dimers or polymers both in vitro and in vivo, indicating that it may play a role in the assembly of RNF17 granules. RNF17 encodes a novel key regulator of spermiogenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BXT8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56163
Name Human RNF17 (aa 465-568) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Mad member-interacting protein 2; Max dimerization protein member-interacting protein 2; Mmip2; Mmip-2; RING finger protein 17; Rnf17; SPATA23; spermatogenesis associated 23; TDRD4; tudor domain containing 4; tudor domain-containing protein 4
Common Name RNF17
Gene Symbol RNF17
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ELGARIFVSSIKNGMWCRGTITELIPIEGRNTRKPCSPTRLFVHEVALIQIFMVDFGNSEVLIVTGVVDTHVRPEHSAKQHIALNDLCLVLRKSEPYTEGLLKD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.