Invitrogen™ Human RNF168 (aa 229-323) Control Fragment Recombinant Protein

Product Code. 30210774

Brand: Invitrogen™ RP104814

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65427 (PA5-65427. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNF168 was identified as a chromatin-associated RING finger protein that acts as a ubiquitin ligase both in vitro and in vivo. RNF168 targets histones H2A and H2AX, but not H2B, forming K63 polyubiquitin chains. Upon formation of DNA double strand breaks, RNF168 is recruited to the site of DNA damage where it co-localizes with -gammaH2AX and 53BP1 in an RNF8-dependent manner. This localization of RNF168 increases the local concentration of ubiquinated proteins to the threshold required for retention of the proteins 53BP1 and BRCA1, facilitating the downstream signaling cascade. Thus, RNF168 defines a new pathway demonstrating a functional cooperation between E3 ligases in genome maintenance. At least three isoforms of RNF168 are known to exist.

Specifications

• Accession Number: Q8IYW5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 165918
• Name: Human RNF168 (aa 229-323) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110001H15Rik; E3 ubiquitin-protein ligase RNF168; FLJ35794; hRNF168; RING finger protein 168; ring finger protein 168, E3 ubiquitin protein ligase; ring fnger protein 168; RING-type E3 ubiquitin transferase RNF168; RNF168
• Common Name: RNF168
• Gene Symbol: RNF168
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTPKSQFGSASHSEAVQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLSPQISLGVGEQGADSSIESPMPWLCACGAEWYHEGNVKTRPSNHGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining