missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206163

Invitrogen™ Human RNF144A (aa 43-120) Control Fragment Recombinant Protein

Product Code. 30206163
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206163

Brand: Invitrogen™ RP100981

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62099 (PA5-62099. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UBCE7IP4 (Ubiquitin-conjugating enzyme 7- interacting protein 4), also known as RNF144A (RING finger protein 144A), KIAA0161 or RNF144, is a 292 amino acid single-pass membrane protein that contains one RING-type zinc finger and two IBR-type zinc fingers. Functioning as an E3 ubiquitin-protein ligase, UBCE7IP4 accepts ubiquitin (in the form of a thioester) from E2 ubiquitin-conjugating enzymes, such as UBC8 and UBCH7, and transfers that ubiquitin residue to target substrates. Via its RING finger, UBCE7IP4 may play a role in protein-DNA and protein-protein interactions throughout the cell.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P50876
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9781
Name Human RNF144A (aa 43-120) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias E3 ubiquitin-protein ligase RNF144A; Kiaa0161; probable E3 ubiquitin-protein ligase RNF144A; RGD1561737; ring finger protein 144; ring finger protein 144 A; RNF144; RNF144A; Ubce7ip4; UbcM4-interacting protein 4; ubiquitin conjugating enzyme 7 interacting protein 4; ubiquitin-conjugating enzyme 7-interacting protein 4; Uip4
Common Name RNF144A
Gene Symbol RNF144A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.