Invitrogen™ Human RNF135 (aa 167-266) Control Fragment Recombinant Protein

Product Code. 30194863

Brand: Invitrogen™ RP93486

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54457 (PA5-54457. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by RNF135 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis.

Specifications

• Accession Number: Q8IUD6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84282
• Name: Human RNF135 (aa 167-266) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610037N03Rik; 2410006N06Rik; E3 ubiquitin-protein ligase RNF135; L13; LRRGT00184; MGC13061; MMFD; REUL; RIG-I E3 ubiquitin ligase; ring finger protein 135; RING finger protein 135; E3 ubiquitin-protein ligase RNF135; RING-type E3 ubiquitin transferase RNF135; Riplet; RNF135; U 2-3-0
• Common Name: RNF135
• Gene Symbol: RNF135
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSILGKAFSSGVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPALRRASRFAQWAIHPTFNLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining