Invitrogen™ Human RNF113A (aa 44-154) Control Fragment Recombinant Protein

Product Code. 30208057

Brand: Invitrogen™ RP91953

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51355 (PA5-51355. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This intronless gene encodes a protein which contains a C3H1-type zinc finger domain and a C3HC4 Ring-type (Really Interesting New Gene-type) zinc finger domain. The Ring-type zinc finger domain is identified in various tumor suppressors, DNA repair genes and cytokine receptor-associated molecules, and is probably involved in mediating protein-protein interactions. [provided by RefSeq, May 2010].

Specifications

• Accession Number: O15541
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7737
• Name: Human RNF113A (aa 44-154) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810428C21Rik; Cwc24; Cwc24 homolog; E3 ubiquitin-protein ligase RNF113A; RING finger protein 113 A; ring finger protein 113A1; RNF113; RNF113A; Rnf113a1; TTD5; Zinc finger protein 183; zinc finger protein 183 (RING finger, C3HC4 type); ZNF183
• Common Name: RNF113A
• Gene Symbol: RNF113A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining