Invitrogen™ Human RNF10 (aa 503-585) Control Fragment Recombinant Protein

Product Code. 30212168

Brand: Invitrogen™ RP103127

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62658 (PA5-62658. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a ring finger motif, which is known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. EST data suggests the existence of multiple alternatively spliced transcript variants, however, their full length nature is not known.

Specifications

• Accession Number: Q8N5U6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9921
• Name: Human RNF10 (aa 503-585) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA675014; Kiaa0262; LOW QUALITY PROTEIN: RING finger protein 10; MGC126758; MGC126764; mKIAA0262; RIE2; RING finger protein 10; Rnf10; Sid 2705; Sid2705
• Common Name: RNF10
• Gene Symbol: RNF10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining