Invitrogen™ Human RND1 (aa 127-179) Control Fragment Recombinant Protein

Product Code. 30195627

Brand: Invitrogen™ RP108124

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67468 (PA5-67468. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lacks intrinsic GTPase activity. Has a low affinity for GDP, and constitutively binds GTP. Controls rearrangements of the actin cytoskeleton. Induces the Rac-dependent neuritic process formation in part by disruption of the cortical actin filaments. Causes the formation of many neuritic processes from the cell body with disruption of the cortical actin filaments.

Specifications

• Accession Number: Q92730
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27289
• Name: Human RND1 (aa 127-179) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A830014L09Rik; Arhs; GTP-binding protein RHO6; ras homolog gene family, member S; Rho family GTPase 1; Rho6; Rho-related GTP-binding protein Rho6; RHOS; RND1; similar to Rho-related GTP-binding protein Rho6 (Rho family GTPase 1) (Rnd1)
• Common Name: RND1
• Gene Symbol: Rnd1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining