missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195086

Invitrogen™ Human RNASET2 (aa 203-249) Control Fragment Recombinant Protein

Product Code. 30195086
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195086

Brand: Invitrogen™ RP103844

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84726 (PA5-84726. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNASET2 is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement, and has been suggested to function as a tumor suppressor protein. Its expression is suppressed in Human T-cell Leukemia Virus type 1 (HTLV-1) infected cells following the binding of the HTLV-1 Tax protein to the RNASET2 promoter. As Adult T-cell leukemia (ATL) is one of the primary diseases caused by HTLV-1 infection, a reduction in the level of RNASET2 by Tax may play a role in ATL development.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O00584
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8635
Name Human RNASET2 (aa 203-249) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610007O07Rik; 4833423A10Rik; 4930532K22Rik; bA514O12.3; C79750; Ribonuclease 6; Ribonuclease 6-A; Ribonuclease 6-B; Ribonuclease T2; ribonuclease T2A; Ribonuclease T2-A; Ribonuclease T2-B; RNase T2; RNASE6PL; RNASET2; Rnaset2a; Rnaset2b; rnt2; RP11-514O12.3
Common Name RNASET2
Gene Symbol RNASET2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.