missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RNaseL (aa 605-733) Control Fragment Recombinant Protein

Product Code. 30212327
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212327

Brand: Invitrogen™ RP110224

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A virally induced endoribonuclease, RNase L is the terminal factor of the anti-viral action of interferon. Activation of RNase L results in inhibition of viral proliferation. Activation of RNase L has also been determined to degrade RNA, thus, initiating a cellular stress response, inducing apoptosis. Since mutations in RNase L relate to an increased incidence of prostate cancer, the activation of RNase L functions in counteracting prostate cancer, via apoptosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q05823
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6041
Name Human RNaseL (aa 605-733) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2',5'-oligoisoadenylate synthetase-dependent; 2-5 A-dependent ribonuclease; 2-5 A-dependent RNAase; 2-5 A-dependent RNase; E230029I04Rik; I79_009550; interferon-induced 2-5 A-dependent RNase; PRCA1; Ribonuclease 4; ribonuclease L; ribonuclease L (2 5-oligoisoadenylate synthetase-dependent); ribonuclease L (2', 5'-oligoisoadenylate synthetase-dependent); ribonuclease L (2, 5-oligoisoadenylate synthetase-dependent); ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent); RNase L; Rnasel; RNS4
Common Name RNaseL
Gene Symbol RNASEL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.