Invitrogen™ Human RNaseL (aa 605-733) Control Fragment Recombinant Protein

Product Code. 30212327

Brand: Invitrogen™ RP110224

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A virally induced endoribonuclease, RNase L is the terminal factor of the anti-viral action of interferon. Activation of RNase L results in inhibition of viral proliferation. Activation of RNase L has also been determined to degrade RNA, thus, initiating a cellular stress response, inducing apoptosis. Since mutations in RNase L relate to an increased incidence of prostate cancer, the activation of RNase L functions in counteracting prostate cancer, via apoptosis.

Specifications

• Accession Number: Q05823
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6041
• Name: Human RNaseL (aa 605-733) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2',5'-oligoisoadenylate synthetase-dependent; 2-5 A-dependent ribonuclease; 2-5 A-dependent RNAase; 2-5 A-dependent RNase; E230029I04Rik; I79_009550; interferon-induced 2-5 A-dependent RNase; PRCA1; Ribonuclease 4; ribonuclease L; ribonuclease L (2 5-oligoisoadenylate synthetase-dependent); ribonuclease L (2', 5'-oligoisoadenylate synthetase-dependent); ribonuclease L (2, 5-oligoisoadenylate synthetase-dependent); ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent); RNase L; Rnasel; RNS4
• Common Name: RNaseL
• Gene Symbol: RNASEL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining