Invitrogen™ Human RNASE3 (aa 82-136) Control Fragment Recombinant Protein

Product Code. 30207565

Brand: Invitrogen™ RP95687

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63260 (PA5-63260. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ECP (eosinophil cationic protein), also known as RNS3 or RNASE3 (ribonuclease, RNase A family, 3), is a 160 amino acid potent cytotoxic secretory protein that belongs to the pancreatic ribonuclease family. ECP localizes to the granule matrix of the eosinophil and is involved in the immune response system. ECP is a cytotoxin, neurotoxin and helminthotoxin that is secreted by activated human eosinophils. ECP exhibits anti-parasitic, antibacterial and ribonucleolytic activities. It has been suggested that ECP induces the neurotoxic effect known as the Gordon phenomenon, a syndrome manifested by ataxia, muscular rigidity, paralysis and tremor that may lead to death. ECP is considered a marker of eosinophilic inflammation and high levels have been found in cases of active asthma and other allergic diseases.

Specifications

• Accession Number: P12724
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6037
• Name: Human RNASE3 (aa 82-136) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cytotoxic ribonuclease; Ear11; EAR-11; Ear3; ECP; Eosinophil cationic protein; eosinophil cationic protein-like; eosinophil cationic-type ribonuclease 3; Eosinophil secondary granule ribonuclease 11; eosinophil-associated ribonuclease 3; eosinophil-associated, ribonuclease A family, member 3; LOC100361866; mR3; MR-3; murine ribonuclease 3; RAF1; Ribonuclease 3; ribonuclease A family member 3; ribonuclease, RNase A family 3; ribonuclease, RNase A family, 3; RNase 3; RNASE3; RNS3
• Common Name: RNASE3
• Gene Symbol: RNASE3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining