Invitrogen™ Human RMND5A (aa 97-136) Control Fragment Recombinant Protein

Product Code. 30180857

Brand: Invitrogen™ RP99682

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61330 (PA5-61330. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RMND5A is a protein coding gene.

Specifications

• Accession Number: Q9H871
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64795
• Name: Human RMND5A (aa 97-136) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110007A06Rik; 44-kD protein coding for CTLH motif; AJ237586; AW125795; C-terminal to LisH motif, 44 kDa; CTLH; E3 ubiquitin-protein ligase RMND5A; E3 ubiquitin-protein transferase RMND5A; FLJ13910; GID complex subunit 2 homolog A; GID2; GID2A; MTA.D02.090; p44CTLH; Protein RMD5 homolog A; required for meiotic nuclear division 5 homolog A; required for meiotic nuclear division 5 homolog A (S. cerevisiae); RGD1309766; RMD5; RMND5A
• Common Name: RMND5A
• Gene Symbol: RMND5A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining