Invitrogen™ Human RLTPR (aa 729-813) Control Fragment Recombinant Protein

Product Code. 30182080

Brand: Invitrogen™ RP98696

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59553 (PA5-59553. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RLTPR/CARMIL2 (RGD motif, leucine rich repeats, tropomodulin domain and proline-rich containing; capping protein regulator and myosin 1 linker 2), also known as LRRC16C, is a cytosolic protein, which with high affinity binds CAPZA2 (capping protein muscle actin Z-line alpha 2) and decreases CAPZA2 affinity for actin barbed ends. RLTPR/CARMIL2 increases the rate of actin filament elongation from seeds in the presence of CAPZA2, however, seems unable to nucleate filaments. Its interaction with CAPZA2 is essential for lamellipodial protrusion and cell translocation. RLTPR/CARMIL2 is crucial for T cell costimulation via CD28 and this property seems to be independent on its actin-uncapping function. The lack of functional RLTPR/CARMIL2 molecules impeded the differentiation toward Th1 and Th17 fates of both human and murine CD4+ T cells and leads to combined immunodeficiency. Expression of RLTPR/CARMIL2 was also detected in human and murine B cells, but it seems not to be involved in BCR-mediated signaling.

Specifications

• Accession Number: Q6F5E8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 146206
• Name: Human RLTPR (aa 729-813) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Capping protein regulator and myosin 1 linker 2; capping protein, Arp2/3 and myosin-I linker protein 2; CARMIL2; CARMIL2b; CG1399-PB; D130029J02Rik; F-actin-uncapping protein RLTPR; Gm585; leucine rich repeat containing 16 C; leucine-rich repeat-containing protein 16 C; LRRC16C; RGD motif, leucine rich repeats, tropomodulin domain and proline-rich containing; RGD, leucine-rich repeat, tropomodulin and proline-rich containing protein; RGD, leucine-rich repeat, tropomodulin and proline-rich-containing protein; RLTPR
• Common Name: RLTPR
• Gene Symbol: CARMIL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining