Invitrogen™ Human RKHD2 (aa 462-546) Control Fragment Recombinant Protein

Product Code. 30182070

Brand: Invitrogen™ RP98271

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59220 (PA5-59220. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Rkhd2, also known as MEX3C is a member of a novel family of four homologous human MEX3 proteins each containing two heterogeneous nuclear ribonucleoprotein K homology (KH) domains and one carboxy-terminal RING finger module. MEX3 proteins, including Rkhd2, are phosphoproteins that bind RNA through their KH domains and shuttle between the nucleus and the cytoplasm via the CRM1 export pathway. These proteins are a novel family of evolutionarily conserved RNA-binding proteins, differentially recruited to P bodies and potentially involved in post-transcriptional regulatory mechanisms. It has been suggested that genetic variations in Rkhd2 may be associated with susceptibility to essential hypertension type 8. Rkhd3 and Rkhd4, but not Rkhd2, co-localize with both the hDcp1a decapping factor and Argonaute (Ago) proteins in processing bodies (P bodies), recently characterized as centers of mRNA turnover.

Specifications

• Accession Number: Q5U5Q3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51320
• Name: Human RKHD2 (aa 462-546) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A130001D14Rik; BC035207; BM-013; mex-3 homolog C; me x 3 homolog C (C. elegans); mex-3 RNA binding family member C; Me x 3 c; MEX-3 C; ME x 3 C variant 1; ME x 3 C variant 10; ME x 3 C variant 11; ME x 3 C variant 2; ME x 3 C variant 3; ME x 3 C variant 4; ME x 3 C variant 5; ME x 3 C variant 6; ME x 3 C variant 9; ring finger and KH domain containing 2; RING finger and KH domain-containing protein 2; RING finger protein 194; RING-type E3 ubiquitin transferase ME x 3 C; Rkhd2; RNA-binding E3 ubiquitin-protein ligase ME x 3 C; RNA-binding protein ME x 3 C; RNF194
• Common Name: RKHD2
• Gene Symbol: MEX3C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining