Invitrogen™ Human RIT1 (aa 166-219) Control Fragment Recombinant Protein

Product Code. 30212047

Brand: Invitrogen™ RP101351

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111371 (PA5-111371. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Rit and its neuron-specific homologue, Rin, define a recently discovered subfamily of Ras-related GTPases. Rit and Rin are membrane-associated in spite of the fact that they lack a CAAX box or similar C-terminal lipidation motif. Rit and Rin display 64% amino acid sequence identity and share a unique nine amino acid effector domain (DPTIEDAYK) that is 100% conserved between the murine and human proteins. Although the effector domain sequences of Rit and Rin are very similar to that of Ras, Rit and Rin have been shown to interact with the known Ras-binding proteins RalGDS, Rlf and AF-6, but not the Raf kinases, RIN1 or the p110 subunit of PI3 kinase. For this reason, it has been suggested that Rit and Rin may play important roles in the regulation of signaling pathways distinct from those controlled by Ras.

Specifications

• Accession Number: Q92963
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6016
• Name: Human RIT1 (aa 166-219) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: GTP-binding protein Rit1; GTP-binding protein Roc1; MGC125864; MGC125865; NS8; Ras like without CAAX 1; ras-like protein expressed in many tissues; Ras-like without CAAX 1; ras-like without CAAX protein 1; RGD1559874; RIBB; Ric-like, expressed in many tissues; RIT; RIT1; ROC1; si:ch211-93a2.3
• Common Name: RIT1
• Gene Symbol: RIT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining