Invitrogen™ Human RISC (aa 119-191) Control Fragment Recombinant Protein

Product Code. 30213413

Brand: Invitrogen™ RP103962

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in vascular wall and kidney homeostasis. Target protein may act as a serine carboxypeptidase.

Specifications

• Accession Number: Q9HB40
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 59342
• Name: Human RISC (aa 119-191) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410018F01Rik; 4833411K15Rik; AI957256; HSCP1; MSTP034; retinoid inducible serine carboxypeptidase; retinoid-inducible serine carboxypeptidase; retinoid-inducible serine caroboxypeptidase; retinoid-inducible serine caroboxypetidase; Risc; SCP1; SCPEP1; Serine carboxypeptidase 1; serine carboxypeptidase 1 precursor protein; serine caroboxypeptidase 1; UNQ265/PRO302
• Common Name: RISC
• Gene Symbol: SCPEP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTGFSYVNGSGAYAKDLAMVASDMMVLLKTFFSCHKEFQTVPFYIFSESYGGKMAAGIGLELYKAIQRGTIKC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining