Invitrogen™ Human RIPX (aa 1-83) Control Fragment Recombinant Protein

Product Code. 30195731

Brand: Invitrogen™ RP93568

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54644 (PA5-54644. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Implicated in the formation of a single axon by developing neurons. May inhibit the formation of additional axons by inhibition of PI3K in minor neuronal processes.

Specifications

• Accession Number: Q7L099
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22902
• Name: Human RIPX (aa 1-83) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810428M05Rik; 6330416M07Rik; AW455998; AW538594; D5Bwg0860e; KIAA0871; Protein RUFY3; rap2 interacting protein x; rap2-interacting protein x; RIPx; Rpipx; RUFY3; RUN and FYVE domain containing 3; RUN and FYVE domain-containing protein 3; Singar; SINGAR1; singar2; single axon-regulated protein; Single axon-regulated protein 1; single axon-related 1; ZFYVE30
• Common Name: RIPX
• Gene Symbol: RUFY3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERMNLMNMAKLSIKGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining