Invitrogen™ Human RIPPLY1 (aa 46-98) Control Fragment Recombinant Protein

Product Code. 30181990

Brand: Invitrogen™ RP98486

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62584 (PA5-62584. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein similar to a zebrafish protein which acts as a transcriptional repressor in and is required for somite segmentation in zebrafish embryos. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q0D2K3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 92129
• Name: Human RIPPLY1 (aa 46-98) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: protein ripply1; ripply transcriptional repressor 1; RIPPLY1; ripply1 homolog
• Common Name: RIPPLY1
• Gene Symbol: RIPPLY1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVNGSERGTCLWRPWLSSTNDSPRQMRKLVDLAAGGATAAEVTKAESKFHHPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining