Invitrogen™ Human RIP2 (aa 218-342) Control Fragment Recombinant Protein

Product Code. 30207860

Brand: Invitrogen™ RP91408

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RIPK2 is a serine/threonine kinase that is involved in cell activation, proliferation, differentiation, and apoptosis. Upon stimulation by bacterial peptidoglycans, NOD1 and NOD2 are activated, oligomerize and recruit RIPK2 through CARD-CARD domains. Contributes to the tyrosine phosphorylation of the guanine exchange factor ARHGEF2 through Src tyrosine kinase leading to NF-kappaB activation by NOD2. Once recruited, RIPK2 autophosphorylates and undergoes 'Lys-63'-linked polyubiquitination by E3 ubiquitin ligases XIAP, BIRC2 and BIRC3. The polyubiquitinated protein mediates the recruitment of MAP3K7/TAK1 to IKBKG/NEMO and induces 'Lys-63'-linked polyubiquitination of IKBKG/NEMO and subsequent activation of IKBKB/IKKB. In turn, NF-kappa-B is released from NF-kappa-B inhibitors and translocates into the nucleus where it activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Plays also a role during engagement of the T-cell receptor (TCR) in promoting BCL10 phosphorylation and subsequent NF-kappa-B activation.

Specifications

• Accession Number: O43353
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8767
• Name: Human RIP2 (aa 218-342) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210420D18Rik; CARD3; CARD-carrying kinase; CARD-containing IL-1 beta ICE-kinase; CARD-containing interleukin-1 beta-converting enzyme (ICE)-associated kinase; CARD-containing interleukin-1 beta-converting enzyme-associated kinase; CARDIAK; CCK; D4Bwg0615e; EC 2.7.11.1; GIG30; growth-in; growth-inhibiting gene 30; kinase RIPK2; receptor (TNFRSF)-interacting serine-threonine kinase 2; receptor interacting serine/threonine kinase 2; receptor-interacting protein (RIP)-like interacting caspase-like apoptosis regulatory protein (CLARP) kinase; receptor-interacting protein 2; receptor-interacting serine/threonine-protein kinase 2; receptor-interacting serine-threonine kinase 2; RICK; RIP 2; RIP2; RIP-2; Ripk2; RIP-like; RIP-like-interacting CLARP kinase; Tyrosine-protein kinase RIPK2; UNQ277/PRO314/PRO34092; WUGSC:H_RG437L15.1
• Common Name: RIP2
• Gene Symbol: RIPK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining