Invitrogen™ Human RIP140 (aa 271-373) Control Fragment Recombinant Protein

Product Code. 30203681

Brand: Invitrogen™ RP95903

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nuclear receptor interacting protein 1 is a nuclear protein that specifically interacts with the hormone-dependent activation domain AF2 of nuclear receptors. Also known as RIP140, this protein modulates transcriptional activity of the estrogen receptor.

Specifications

• Accession Number: P48552
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8204
• Name: Human RIP140 (aa 271-373) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ERAP 140; FLJ77253; NRIP1; Nuclear factor RIP140; nuclear receptor interacting protein 1; nuclear receptor-interacting protein 1; OTTHUMP00000083036; OTTHUMP00000083037; Receptor-interacting protein 140; RIP140
• Common Name: RIP140
• Gene Symbol: NRIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining