missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RIOK3 (aa 26-147) Control Fragment Recombinant Protein

Product Code. 30210266
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210266

Brand: Invitrogen™ RP101004

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55005 (PA5-55005. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The phosphorylation and dephosphorylation of proteins on serine and threonine residues is an essential means of regulating a broad range of cellular functions in eukaryotes, including cell division, homeostasis and apoptosis. A group of proteins that are intimately involved in this process are the serine/threonine (Ser/Thr) protein kinases. SUDD, also known as RIOK3 (RIO kinase 3), is a 519 amino acid protein that contains one protein kinase domain and belongs to the Ser/Thr protein kinase family. Expressed in a variety of tissues, SUDD catayzes the ATP-dependent phosphorylation of target proteins, thereby influencing signaling events throughout the cell. SUDD is expressed as two isoforms due to alternative splicing events.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O14730
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8780
Name Human RIOK3 (aa 26-147) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200013N13Rik; D18Ertd331e; E130306C24Rik; homolog of the Aspergillus nidulans sudD gene product; RIO kinase 3; RIOK3; Serine/threonine-protein kinase RIO3; SUDD; sudD (suppressor of bimD6, Aspergillus nidulans) homolog; sudD homolog; sudD suppressor of Aspergillus nidulans bimD6 homolog; sudD suppressor of bimD6 homolog; sudD, suppressor of bimD6 homolog; testicular secretory protein Li 47
Common Name RIOK3
Gene Symbol RIOK3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IPQNTISCSLADVMSEQLAKELQLEEEAAVFPEVAVAEGPFITGENIDTSSDLMLAQMLQMEYDREYDAQLRREEKKFNGDSKVSISFENYRKVHPYEDSDSSEDEVDWQDTRDDPYRPAKP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.