Invitrogen™ Human RINL (aa 218-304) Control Fragment Recombinant Protein

Product Code. 30181846

Brand: Invitrogen™ RP99191

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59868 (PA5-59868. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Guanine nucleotide exchange factor (GEF) for RAB5A and RAB22A that activates RAB5A and RAB22A by exchanging bound GDP for free GTP. Plays a role in endocytosis via its role in activating Rab family members.

Specifications

• Accession Number: Q6ZS11
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 126432
• Name: Human RINL (aa 218-304) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Ras and Rab interactor like; Ras and Rab interactor-like; ras and Rab interactor-like protein; RINL
• Common Name: RINL
• Gene Symbol: RINL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPEVDHPGPALASLLEEEEEDLEGKEEGREDDPEEEGPEDVLTIHVQSLVRARSSYVARQYRSLRVRIASDSGGPHGSGDPATELLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining