Invitrogen™ Human RIMKLA (aa 297-389) Control Fragment Recombinant Protein

Product Code. 30203143

Brand: Invitrogen™ RP94473

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55705 (PA5-55705. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the synthesis of N-acetyl-L-aspartyl-L-glutamate (NAAG) and N-acetyl-L-aspartyl-L-glutamyl-L-glutamate.

Specifications

• Accession Number: Q8IXN7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 284716
• Name: Human RIMKLA (aa 297-389) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B930030J24; Fam80a; family with sequence similarity 80, member A; NAAG synthetase A; NAAGS; NAAGS-II; N-acetylaspartylglutamate synthase A; N-acetylaspartyl-glutamate synthetase A; N-acetylaspartylglutamate synthetase II; N-acetylaspartylglutamylglutamate synthase A; ribosomal modification protein rimK like family member A; ribosomal modification protein rimK-like family member A; ribosomal protein S6 modification-like protein A; Rimk; Rimkla; RP11-157D18.1
• Common Name: RIMKLA
• Gene Symbol: RIMKLA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DYTMSLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEIRDSSASTMGAPPSMLPEPGYNINNRIASELK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining