Invitrogen™ Human RIM2 Control Fragment Recombinant Protein

Product Code. 30209171

Brand: Invitrogen™ RP107501

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84724 (PA5-84724. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Rab3-interacting molecules (RIMs) are synaptic proteins necessary for neuronal transmission and plasticity. Rim1 and Rim2 proteins are expressed in overlapping but distinct patterns throughout the brain. While the ablation of either gene was not lethal in mice, the deletion of both resulted in postnatal mortality. This lethality is due to a defect in neurotransmitter release; synapses without RIM proteins can still release neurotransmitters but are unable to do so in response to normal Ca2+ triggers. Like Rim1, Rim2 is thought to be an effector protein for Rab3, binding to Rab3 on synaptic vesicles in a GTP-dependent manner.

Specifications

• Accession Number: Q9UQ26
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9699
• Name: Human RIM2 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810036I15Rik; AW048769; KIAA0751; mKIAA0751; Nim2; non-small cell lung cancer RimL3a protein; non-small cell lung cancer RimL3c protein; nuclear protein; OBOE; Rab3 interacting protein 1; Rab3 interacting protein 2; RAB3 interacting protein 3; Rab-3-interacting molecule 2; rab3-interacting molecule 2; Rab3-interacting protein; rab-3-interacting protein 2; rab3-interacting protein 2; Rab-3-interacting protein 3; Rab3ip2; RAB3IP3; regulating synaptic membrane exocytosis 2; regulating synaptic membrane exocytosis protein 2; RIM 2; Rim2; RIM2 (CT); Rim2(+40 A); Rim2(+44 A); Rim2(+4 A); Rims2; Serg2; synaptic exocytosis regulator 2; synaptotagmin 3, related sequence; Syt3-rs
• Common Name: RIM2
• Gene Symbol: Rims2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining