Invitrogen™ Human RIG-I (aa 501-635) Control Fragment Recombinant Protein

Product Code. 30205233

Brand: Invitrogen™ RP104832

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111253 (PA5-111253. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Retinoic acid-inducible gene I, RIG-I is a pattern recognition receptor (PRR) involved in the recognition of viral dsRNA. Along with MDA5, RIG-I detects viral dsRNA and activates the innate immune response. Both MDA5 and RIG-I are RNA helicases and they perform overlapping as well as distinct roles. RIG-I is activated by dsRNAs without a 5'-triphosphate end and short dsRNAs, whereas MDA5 is activated by long dsRNAs. Once activated, both proteins signal through IPS-1 activating transcription factors NF-kappaB and IRF-3 (1) and ultimately activating apoptosis, cytokine signaling, and inflammation. RIG-I is essential for signaling by influenza A, influenza B, human respiratory syncytial virus (3), paromyxoviruses, Japanese encephalitis virus, and West Nile virus. MicroRNA-146a has been implicated in feedback inhibition of RIG-I-dependant antiviral response by negatively regulating RIG-I targets TRAF6, IRAK1, and IRAK2. Recent evidence has implicated RIG-I in the detection of cytosolic DNA through RNA polymerase III activity.

Specifications

• Accession Number: O95786
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23586
• Name: Human RIG-I (aa 501-635) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6430573D20Rik; C330021E21; Dd x 58; DEAD (Asp-Glu-Ala-Asp) box polypeptide 58; DEAD box protein 58; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide; DEAD/H box polypeptide RIG-I; DEAD-box protein 58; DEXD/H-box helicase 58; probable ATP-dependent RNA helicase DD x 58; Retinoic acid-inducible gene 1 protein; retinoic acid-inducible gene I protein; retinoic acid-inducible gene-I; RIG-1; RIGI; RIG-I; RIG-I-like receptor 1; RLR-1; RNA helicase RIG-I; SGMRT2
• Common Name: RIG-I
• Gene Symbol: DDX58
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining