Invitrogen™ Human RICTOR (aa 818-916) Control Fragment Recombinant Protein

Product Code. 30196850

Brand: Invitrogen™ RP102786

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111087 (PA5-111087. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RICTOR and MTOR (FRAP1) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth.

Specifications

• Accession Number: Q6R327
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 253260
• Name: Human RICTOR (aa 818-916) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921505C17Rik; 6030405M08Rik; AVO3; AVO3 homolog; AW492497; D530039E11Rik; DKFZp686B11164; Fyb; FYN binding protein; hAVO3; Kiaa1999; mAVO3; MGC39830; PIA; pianissimo; protein pianissimo; Rapamycin-insensitive companion of mTOR; rictor; RPTOR independent companion of MTOR complex 2; RPTOR independent companion of MTOR, complex 2; TORC2-specific protein AVO3
• Common Name: RICTOR
• Gene Symbol: Rictor
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LNERGYVAKQLEKWHREYNSKYVDLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining