Invitrogen™ Human Ribophorin I (aa 215-356) Control Fragment Recombinant Protein

Product Code. 30197011

Brand: Invitrogen™ RP102438

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82937 (PA5-82937. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ribophorins 1 and 2 are abundant and highly conserved glycoproteins residing in the endoplasic reticulum, that participate in ribosome binding. Mammalian oligosaccharyltransferase activity is associated with a protein complex composed of RPN1, RPN2, and an oligosaccharyltransferase protein. RPN1 is a component of the proteasome base. The ubiquitin-like (UBL) domain of recombinant Rad23 interacts with proteasomes through the leucine-rich repeat domain of RPN1. The RPN1 gene maps to chromosome 3 in somatic cell hybrids, and the RPN2 gene maps to chromosome 20 by in situ hybridization.

Specifications

• Accession Number: P04843
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6184
• Name: Human Ribophorin I (aa 215-356) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU018702; D6Wsu137e; Dolichyl-diphosphooligosaccharide--protein; dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit; dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1; oligosaccharyltransfe; oligosaccharyltransferase 1 homolog; oligosaccharyltransferase complex subunit (non-catalytic); OST1; QccE-21639; QtsA-18349; RBPH1; RIBI; ribophorin I; Ribophorin-1; RPN1; Rpn-1; RPN-I; unnamed protein product
• Common Name: Ribophorin I
• Gene Symbol: RPN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining