missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205250

Invitrogen™ Human RIAM (aa 1-144) Control Fragment Recombinant Protein

Product Code. 30205250
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205250

Brand: Invitrogen™ RP88818

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53532 (PA5-53532. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RIAM appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. Suppresses insulin-induced promoter activities through AP1 and SRE. Mediates Rap1-induced adhesion.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7Z5R6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54518
Name Human RIAM (aa 1-144) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9930118P07Rik; amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein; amyloid beta A4 precursor protein-binding family B member 1-interacting protein; amyloid beta precursor protein binding family B member 1 interacting protein; APBB1-interacting protein 1; Apbb1ip; INAG1; Prel1; PREL-1; proline rich EVH1 ligand 1; proline-rich EVH1 ligand 1; Proline-rich protein 48; proline-rich protein 73; Prp48; Rap1-GTP-interacting adapter molecule; Rap1-GTP-interacting adaptor molecule; Rap1-interacting adaptor molecule; RARP1; RARP-1; retinoic acid-responsive proline-rich protein 1; RIAM; RIAMRARP-1; zgc:63968
Common Name RIAM
Gene Symbol APBB1IP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.