Invitrogen™ Human RHOT2 (aa 489-589) Control Fragment Recombinant Protein

Product Code. 30196407

Brand: Invitrogen™ RP90281

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53007 (PA5-53007. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the Rho family of GTPases. The encoded protein is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics.

Specifications

• Accession Number: Q8IXI1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 89941
• Name: Human RHOT2 (aa 489-589) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Arht2; C16orf39; hypothetical protein LOC557574; Miro2; MIRO-2; mitochondrial Rho (MIRO) GTPase 2; mitochondrial Rho 2; mitochondrial Rho GTPase 2; ras homolog family member T2; Ras homolog gene family member T2; ras homolog gene family, member T2; RASL; Rhot2; zgc:123249
• Common Name: RHOT2
• Gene Symbol: RHOT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining