Invitrogen™ Human RhoGAP (aa 17-138) Control Fragment Recombinant Protein

Product Code. 30203323

Brand: Invitrogen™ RP102445

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82157 (PA5-82157. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The p190 RhoGAP protein is associated with p120 RasGAP in growth-factor stimulated and tyrosine kinase transformed cells. It functions as a GTPase - activating protein (GAP) for Rho and Rac family proteins, which are involved in regulating cytoskeletal actin and membrane ruffling. The antibody appears to couple signal transduction via Ras and Rho through its association with RasGAP. The presence of two adjacent SH2 domains in the p21 RAS GAP indicates that GAP might interact directly with tyrosine kinases.

Specifications

• Accession Number: Q07960
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 392
• Name: Human RhoGAP (aa 17-138) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ARHGAP1; ARHGAP5; B230365D05Rik; C76222; CDC42 GTPase-activating protein; CDC42GAP; GFI2; growth factor independent 2; GTPase-activating protein rhoGAP; GTPase-activating protein rhoOGAP; GTPase-activating protein, Rho, 1; LOC512817 protein; p100 RasGAP-associated p105 protein; p105 RhoGAP; p190-B; p190BRhoGAP; p50rhoGAP; p50-RhoGAP; Rho GTPase activating protein 1; Rho GTPase activating protein 5; rho GTPase-activating protein 1; Rho GTPase-activating protein 5; RHOGAP; RHOGAP1; RHOGAP5; rho-related small GTPase protein activator; Rho-type GTPase-activating protein 1; rho-type GTPase-activating protein 5
• Common Name: RhoGAP
• Gene Symbol: ARHGAP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining