Invitrogen™ Human RhoBTB1 (aa 297-367) Control Fragment Recombinant Protein

Product Code. 30195692

Brand: Invitrogen™ RP104714

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65259 (PA5-65259. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RHOBTB1 (Rho-related BTB domain-containing protein 1) and RHOBTB3 (Rho-related BTB domain-containing protein 3) each contain two BTB (POZ) domains and belong to the RhoBTB subfamily of Rho GTPases. Members of the RhoBTB subfamily are evolutionarily conserved and are characterized by a proline-rich region, a GTPase domain and two tandem BTB repeats. While both RHOBTB1 and RHOBTB3 are expressed ubiquitously, RHOBTB1 is found at high levels in placenta, stomach, testis, kidney and skeletal muscle, whereas RHOBTB3 is found at high levels in neural and cardiac tissues. RHOBTB1 is thought to play a role in GTPase-mediated signaling and may participate in organization of the Actin filament system. Additionally, RHOBTB1 expression is decreased in head and neck carcinomas, suggesting a possible role for RHOBTB1 as a tumor suppressor.

Specifications

• Accession Number: O94844
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9886
• Name: Human RhoBTB1 (aa 297-367) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700008H16Rik; 3110048G13Rik; AI173445; AI573858; AV350930; DBC2; KIAA0717; KIAA0740; MGC33059; MGC33841; p83; Rho related BTB domain containing 1; Rhobtb1; RHOBTB2; Rho-related BTB domain containing 1; rho-related BTB domain-containing protein 1; zmp:0000000868
• Common Name: RhoBTB1
• Gene Symbol: RHOBTB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LMECEESPNGSEGACEKEKQSRDFQGRILSVDPEEEREEGPPRIPQADQWKSSNKSLVEALGLEAEGAVPE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining