missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RHEBL1 (aa 1-59) Control Fragment Recombinant Protein

Product Code. 30180620
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180620

Brand: Invitrogen™ RP97807

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62732 (PA5-62732. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RhebL1 (ras homolog enriched in brain-like protein 1), also known as Rheb2 or GTPase RhebL1, is a 183 amino acid protein that belongs to the small GTPase superfamily and Rheb family. Localizing to the cell membrane as well as the cytoplasm, RhebL1 is ubiquitously expressed and is increased two-fold in many tumor cell lines. RhebL1 exhibits GTPase activity and may activate NF-kappa-B-mediated gene transcription. Regulating the activity of Rictor, RhebL1 also promotes signal transduction. RhebL1 exists as two alternatively spliced isoforms and is encoded by a gene that maps to human chromosome 12q13.12 and mouse chromosome 15 F1. Human chromosome 12 encodes over 1,100 genes and comprises approximately 4.5% of the human genome. Chromosome 12 is associated with a variety of diseases and afflictions, including hypochondrogenesis, achondrogenesis, Kniest dysplasia, Noonan syndrome and trisomy 12p, which causes facial developmental defects and seizure disorders. Binds GTP and exhibits intrinsic GTPase activity. May activate NF-kappa-B-mediated gene transcription. Promotes signal transduction through MTOR, activates RPS6KB1, and is a downstream target of the small GTPase-activating proteins TSC1 and TSC2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TAI7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 121268
Name Human RHEBL1 (aa 1-59) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810036J22Rik; GTPase RhebL1; ras GTPase; Ras homolog enriched in brain like 1; Ras homolog enriched in brain like 1 c; ras homolog enriched in brain like-1 c; Ras homolog enriched in brain-like 1; ras homolog enriched in brain-like protein 1; RHEB like 1; Rheb2; RHEBL1; RHEBL1c; rheb-like protein 1
Common Name RHEBL1
Gene Symbol RHEBL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.