Invitrogen™ Human RHBG (aa 363-394) Control Fragment Recombinant Protein

Product Code. 30198622

Brand: Invitrogen™ RP104756

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65338 (PA5-65338. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RHBG encodes one of two non-erythroid members of the Rhesus (Rh) protein family. Non-erythroid Rh protein family members are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. All Rh family proteins are predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini.

Specifications

• Accession Number: Q9H310
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57127
• Name: Human RHBG (aa 363-394) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Ammonium transporter Rh type B; Rh family B glycoprotein; Rh family B glycoprotein (gene/pseudogene); rh family type B glycoprotein; Rh family, B glycoprotein; Rh type B glycoprotein; Rhbg; Rhesus blood group family type B glycoprotein; Rhesus blood group, B glycoprotein; Rhesus blood group-associated B glycoprotein; SLC42A2
• Common Name: RHBG
• Gene Symbol: RHBG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ATHEAYGDGLESVFPLIAEGQRSATSQAMHQL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining