Invitrogen™ Human RHBDD3 (aa 249-327) Control Fragment Recombinant Protein

Product Code. 30181839

Brand: Invitrogen™ RP99855

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60571 (PA5-60571. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Rhomboid family of proteins is made up of several widely conserved polytopic membrane serine proteases that play roles in growth and development. RHBDD3 was initially identified as a novel pituitary tumor apoptosis gene (PTAG) whose expression was reduced in certain pituitary adenomas. Overexpression of RHBDD3 in AtT20 cells showed an increase in apoptotic activity and caspase activation in response to bromocriptine, and apoptosis-inducing dopamine D2 analog, suggesting that reactivation of RHBDD3 in tumors may be a therapeutically useful tool. Later experiments also showed that RHBDD3 expression is also reduced in several primary colorectal tumors, indicating that loss of RHBDD3 contributes to a blunted apoptotic response and probably predisposes cells towards malignant transformation.

Specifications

• Accession Number: Q9Y3P4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25807
• Name: Human RHBDD3 (aa 249-327) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C22orf3; CTA-984G1.4; HS984G1A; pituitary tumor apoptosis; pituitary-derived proapoptotic; PTAG; RGD1311827; Rhbdd3; rhomboid domain containing 3; rhomboid domain-containing protein 3
• Common Name: RHBDD3
• Gene Symbol: RHBDD3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining